PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 349aa    MW: 39208.2 Da    PI: 6.2208
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11270.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
       KHN11270.1 14 RGLWSPEEDEKLINYITTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding45.22.2e-1467109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
       KHN11270.1  67 RGSFSPQEAALIIELHCILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.506965IPR017930Myb domain
SuperFamilySSF466893.71E-2911108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001674.89E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.19766116IPR017930Myb domain
SMARTSM007178.3E-1466114IPR001005SANT/Myb domain
PfamPF002493.6E-1367110IPR001005SANT/Myb domain
CDDcd001674.33E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT TYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SPQEAALIIE LHCILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLLSRD  120
VNIPPLATFS DFHSPGFNVG TMESLFPFTA NPNVILNFHH HADQLYLPTT PISPILEGFD  180
HINNDVKLGI DSNYNANNFL HIQNPTPEIV LPLSSNNPSS YEDTWSLGCV ALHLNPNQEN  240
DQIIKSDDTT LHYVVDKFFN PMALLQHYEG QLVEPIVPKV SDIEDYVCSI QEHEATTAKF  300
QCYSQDLTVA SNQLEYIDAF MSSLPSSTTS SAASSSQIVP NPIPSGWES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1369555e-82AC136955.20 Medicago truncatula clone mth2-10p1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006585515.10.0PREDICTED: transcription factor MYB26-like
TrEMBLA0A0B2PQE40.0A0A0B2PQE4_GLYSO; Transcription factor MYB86
TrEMBLK7L7K80.0K7L7K8_SOYBN; Uncharacterized protein
STRINGGLYMA08G20440.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.25e-81myb domain protein 26
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]